Invitrogen™ Human DCTN5 (aa 91-176) Control Fragment Recombinant Protein

Product Code. 30196246

Brand: Invitrogen™ RP105275

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66625 (PA5-66625. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene of this gene is located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Specifications

• Accession Number: Q9BTE1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84516
• Name: Human DCTN5 (aa 91-176) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930427E12Rik; b2b315Clo; C78178; dctn5; dynactin 4; dynactin 5; dynactin 5 (p25); dynactin subunit 5; dynactin subunit 5-like protein; dynactin subunit p25; MGC3248 protein; p25; p25 dynactin subunit; RGD1305654; zgc:92842
• Common Name: DCTN5
• Gene Symbol: DCTN5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining