Invitrogen™ Human DCP1B (aa 132-236) Control Fragment Recombinant Protein

Product Code. 30182801

Brand: Invitrogen™ RP97782

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58894 (PA5-58894. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DCP1B is a core component of the mRNA decapping complex, a key factor in the regulation of mRNA decay.

Specifications

• Accession Number: Q8IZD4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 196513
• Name: Human DCP1B (aa 132-236) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B930050E02Rik; DCP1; DCP1 decapping enzyme homolog b; DCP1 decapping enzyme homolog B (S. cerevisiae); Dcp1b; decapping enzyme hDcp1b; decapping mRNA 1 B; hDcp1b; mRNA-decapping enzyme 1 B; RGD1562214
• Common Name: DCP1B
• Gene Symbol: DCP1B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QYEQLKAHQGTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQRIPQPNQTLDPEPQHLSLTALFGKQD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining