Invitrogen™ Human DCLK3 (aa 207-321) Control Fragment Recombinant Protein

Product Code. 30205650

Brand: Invitrogen™ RP109973

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144847 (PA5-144847. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DCLK3 is one of three doublecortin-like kinases similar to the Ca2+/calmodulin-dependent protein kinase (CaMK) family. DCLK3 mRNA, like that of the homologous DCLK1 and DCLK3, is highly expressed in adult brain, but only DCLK3 transcripts are present in liver and kidney, suggesting that DCLK3 may play other roles than in cortical development. The DCLK proteins are homologous to Doublecortin (DCX), a protein that is mutated in X-linked human lissencephaly. In mouse models where the DCX gene has been disrupted, DCLK1 expression increases slightly and appears to compensate for the loss of DCX, as mice mutant for both DCX and DCLK1 show a severe phenotype including perinatal lethality, disorganized neocortical layering, and profound hippocampal cytoarchitectural disorganization.

Specifications

• Accession Number: Q9C098
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85443
• Name: Human DCLK3 (aa 207-321) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC056929; C730036H08; CLICK-I and II-related; Click-I, -II related; CLICK-I,II-related; CLR; Dcamkl3; DCDC3C; DCK3; Dclk3; doublecortin and CaM kinase-like 3; doublecortin domain-containing protein 3 C; doublecortin like kinase 3; doublecortin-like and CAM kinase-like 3; Doublecortin-like kinase 3; hCG_16695; KIAA1765; RGD1309232; serine/threonine-protein kinase DCLK3
• Common Name: DCLK3
• Gene Symbol: DCLK3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining