Invitrogen™ Human DCHS2 (aa 2519-2596) Control Fragment Recombinant Protein

Product Code. 30198024

Brand: Invitrogen™ RP103547

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64156 (PA5-64156. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q6V1P9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54798
• Name: Human DCHS2 (aa 2519-2596) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cadherin-27; cadherin-like 27; cadherin-like protein CDHJ; Cadherin-like protein VR8; cadherin-related family member 7; CDH27; CDHJ; CDHR7; dachsous cadherin-related 2; DCHS2; PCDH23; PCDHJ; Protein dachsous homolog 2; protocadherin 23; protocadherin PCDHJ; Protocadherin-23
• Common Name: DCHS2
• Gene Symbol: DCHS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining