Invitrogen™ Human DCAF4 (aa 53-116) Control Fragment Recombinant Protein

Product Code. 30198461

Brand: Invitrogen™ RP100870

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61485 (PA5-61485. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nuclear protein p100 is a proliferation-associated protein whose expression is restricted to cell cycle phases S, G2, and M. Exclusively expressed in proliferating cells from the transition G1/S until the end of cytokinesis. During mitosis it is strictly associated with the spindle pole and with the mitotic spindle, whereas during S and G2, it is diffusely distributed throughout the nucleus. The full-length cDNA encodes a 747-amino acid protein with a putative ATP/GTP-binding site motif. RT-PCR analysis demonstrated strong expression of in lung carcinoma cell lines but not in normal lung tissues. Expression was also found in adult placenta, skeletal muscle, thymus, testis, and small intestine and in fetal brain, liver, and kidney. P100 is also correlated to cancer prognosis.

Specifications

• Accession Number: Q8WV16
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26094
• Name: Human DCAF4 (aa 53-116) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110018E21Rik; Dcaf4; DDB1 and CUL4 associated factor 4; DDB1- and CUL4-associated factor 4; DKFZp434K114; WD repeat domain 21; WD repeat domain 21 A; WD repeat-containing protein 21 A; WDR21; WDR21A
• Common Name: DCAF4
• Gene Symbol: DCAF4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining