Invitrogen™ Human DCAF12L2 (aa 67-96) Control Fragment Recombinant Protein

Product Code. 30182293

Brand: Invitrogen™ RP99273

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61855 (PA5-61855. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by Gly-His and Trp-Asp (GH-WD), which may facilitate formation of heterotrimeric or multi-protein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 9. However, the CDS of this intronless gene remains intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. [provided by RefSeq, May 2010].

Specifications

• Accession Number: Q5VW00
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 340578
• Name: Human DCAF12L2 (aa 67-96) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DCAF12L2; DDB1 and CUL4 associated factor 12 like 2; DDB1 and CUL4 associated factor 12-like 2; DDB1- and CUL4-associated factor 12-like protein 2; WD repeat-containing protein 40 C; WDR40C
• Common Name: DCAF12L2
• Gene Symbol: DCAF12L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLQGFEGELRGYAVQRLPELLTERQLDLGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining