missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194180

Invitrogen™ Human DBX2 (aa 287-337) Control Fragment Recombinant Protein

Product Code. 30194180
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194180

Brand: Invitrogen™ RP103622

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64261 (PA5-64261. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DBX2 is a member of the developing brain homeobox (DBX) protein family, but while the related protein DBX1 is expressed in various regions of the developing brain, DBX2 shows a more restricted pattern of expression in the brain, and is also expressed in some mesenchymal cells such as limb buds and tooth germs. It is thought that DBX1 and DBX2 promote the development of a subset of interneurons, some of which help mediate left-right coordination of locomotor activity. In Xenopus, DBX2 is involved in primary neurogenesis and early neural plate patterning, and is thought to act as a cross-repressive partner of NKX6-2 in the patterning of the ventral neural tube.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6ZNG2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 440097
Name Human DBX2 (aa 287-337) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9430056A22Rik; 9630005K15; AI846217; DBX2; developing brain homeobox 2; developing brain homeobox protein 2; Gm1229; Homeobox protein DBX2
Common Name DBX2
Gene Symbol DBX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.