Invitrogen™ Human DBI (aa 1-39) Control Fragment Recombinant Protein

Product Code. 30195957

Brand: Invitrogen™ RP103098

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84066 (PA5-84066. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.

Specifications

• Accession Number: P07108
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1622
• Name: Human DBI (aa 1-39) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACBD 1; ACBD1; ACBP; Acoabp3; acyl coenzyme A binding protein; acyl-CoA binding protein; acyl-CoA-binding protein; acyl-Coenzyme A binding domain containing 1; CCK RP; CCKRP; CCK-RP; cholecystokinin-releasing peptide, trypsin-sensitive; Dbi; diazepam binding inhibitor; Diazepam binding inhibitor (GABA receptor modulator acyl-Coenxyme A binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein); Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenxyme A binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein); diazepam binding inhibitor, acyl-CoA binding protein; diazepam binding inhibitor, splice form 1 b; diazepam-binding inhibitor; Endozepine; EP; GABA receptor modulator; LRRGT00046; MGC70414; octadecaneuropeptide; ODN; RNACOABP3; Triakontatetraneuropeptide; Ttn; valiμm
• Common Name: DBI
• Gene Symbol: DBI
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining