missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DAZL (aa 233-293) Control Fragment Recombinant Protein

Product Code. 30206118
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206118

Brand: Invitrogen™ RP92281

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54079 (PA5-54079. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein expression pattern show that DAZL is involved in mitosis and meiosis of human germ cell. The DAZL gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females.The protein is expressed in germ cells of diverse mammalian species. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In humans, DAZL is expressed in primordial germ cells, adult testis, and the ovary. It plays a central role during spermatogenesis. Defects in DAZL may cause infertility due to severe oligozoospermia (az) and non obstructive azoospermia. The concentrations of DAZL transcripts were lower in men with spermatogenic failure. Drosophila and mouse mutants that have lost DAZ homologous gene function found to be azoospermic, just as with human azoospermia DAZ. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92904
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1618
Name Human DAZL (aa 233-293) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DAZ homolog; DAZH; DAZL; DAZL1; Dazla; Daz-like; DAZ-like autosomal; deleted in azoospermia like; deleted in azoospermia protein 3; deleted in azoospermia-like; Deleted in azoospermia-like 1; deleted in azoospermia-like protein; germline specific RNA binding protein; HGNC:2685; MGC26406; spermatogenesis gene on the Y-like autosomal; SPGYLA; SPGY-like-autosomal; testis secretory sperm-binding protein Li 204 A; Tp x 2; Tpx-2
Common Name DAZL
Gene Symbol DAZL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.