Invitrogen™ Human DAZL (aa 169-231) Control Fragment Recombinant Protein

Product Code. 30194265

Brand: Invitrogen™ RP92280

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54034 (PA5-54034. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein expression pattern show that DAZL is involved in mitosis and meiosis of human germ cell. The DAZL gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females.The protein is expressed in germ cells of diverse mammalian species. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In humans, DAZL is expressed in primordial germ cells, adult testis, and the ovary. It plays a central role during spermatogenesis. Defects in DAZL may cause infertility due to severe oligozoospermia (az) and non obstructive azoospermia. The concentrations of DAZL transcripts were lower in men with spermatogenic failure. Drosophila and mouse mutants that have lost DAZ homologous gene function found to be azoospermic, just as with human azoospermia DAZ. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome.

Specifications

• Accession Number: Q92904
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1618
• Name: Human DAZL (aa 169-231) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DAZ homolog; DAZH; DAZL; DAZL1; Dazla; Daz-like; DAZ-like autosomal; deleted in azoospermia like; deleted in azoospermia protein 3; deleted in azoospermia-like; Deleted in azoospermia-like 1; deleted in azoospermia-like protein; germline specific RNA binding protein; HGNC:2685; MGC26406; spermatogenesis gene on the Y-like autosomal; SPGYLA; SPGY-like-autosomal; testis secretory sperm-binding protein Li 204 A; Tp x 2; Tpx-2
• Common Name: DAZL
• Gene Symbol: DAZL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining