Invitrogen™ Human DAZAP2 (aa 67-132) Control Fragment Recombinant Protein

Product Code. 30194385

Brand: Invitrogen™ RP106103

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65420 (PA5-65420. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DAZAP2 encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma.

Specifications

• Accession Number: Q15038
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9802
• Name: Human DAZAP2 (aa 67-132) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI314727; Brbp; DAZ associated protein 2; DAZAP2; DAZ-associated protein 2; deleted in azoospermia associated protein 2; deleted in azoospermia-associated protein 2; Gcap28; granule cell antiserum positive 28; gt6-12; KIAA0058; mKIAA0058; proline rich protein expressed in brain; proline-rich protein expressed in brain; proline-rich transcript in brain; proline-rich transcript, brain-expressed protein; PRTB
• Common Name: DAZAP2
• Gene Symbol: DAZAP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining