Invitrogen™ Human DARS (aa 1-135) Control Fragment Recombinant Protein

Product Code. 30200812

Brand: Invitrogen™ RP92462

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56266 (PA5-56266. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aspartyl-tRNA synthetase (DARS) is part of a multienzyme complex of aminoacyl-tRNA synthetases. Aspartyl-tRNA synthetase charges its cognate tRNA with aspartate during protein biosynthesis.

Specifications

• Accession Number: P14868
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1615
• Name: Human DARS (aa 1-135) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730439G15Rik; aspartate tRNA ligase 1, cytoplasmic; aspartate--tRNA ligase, cytoplasmic; Aspartyl-tRNA synthetase; aspartyl-tRNA synthetase, cytoplasmic; aspRS; Cell proliferation-inducing gene 40 protein; Dars; DRS1; HBSL; PIG40; testicular tissue protein Li 192
• Common Name: DARS
• Gene Symbol: DARS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining