missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182483

Invitrogen™ Human DARPP-32 (aa 33-107) Control Fragment Recombinant Protein

Product Code. 30182483
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182483

Brand: Invitrogen™ RP98437

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DARPP-32 is a dopamine (DA) and AMP-regugated ∽32 kDa phosphoprotein that is associated with dopaminoceptive neurons. The protein inhibits Protein Phosphatase I when it is phosphorylated on Thr34. In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA. Phosphorylation of DARPP-32 is thought to play a critical role in the regugation of dopaminergic neurotransmission. In addition, the activity of DARPP-32 is also thought to play important roles in the actions of alcohol, caffeine and Prozac™.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UD71
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84152
Name Human DARPP-32 (aa 33-107) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AU040756; DARPP32; DARPP-32; dopamine- and cAMP-regulated neuronal phosphoprotein; dopamine and cAMP-regulated neuronal phosphoprotein 32; dopamine- and cAMP-regulated phosphoprotein DARPP-32; FLJ20940; IPPD; neuronal phosphoprotein DARPP-32; OTTHUMP00000164275; OTTHUMP00000164276; Ppp1r1b; PPR1B; protein pho; protein phosphatase 1 regulatory inhibitor subunit 1 B; protein phosphatase 1 regulatory subunit 1 B; protein phosphatase 1, regulatory (inhibitor) subunit 1 B
Common Name DARPP-32
Gene Symbol Ppp1r1b
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.