Invitrogen™ Human DAPK1 (aa 1146-1289) Control Fragment Recombinant Protein

Product Code. 30206332

Brand: Invitrogen™ RP103024

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83910 (PA5-83910. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DAPK1 is a large, calmodulin-dependent kinase involved in gamma-interferon induced programmed cell death and is a potential tumor suppressor. DAPK1 is involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and authophagy. It regulates both type I apoptotic and type II autophagic cell death signal, depending on the cellular setting. Type I apoptotic cell death is caspase-dependent, type II authophagic cell death is caspase-independent. DAPK1 phosphorylates PIN1 resulting in inhibition of its catalytic activity, nuclear localization, and cellular function. It also phosphorylates TPM1, STX1A, PRKD1, BECN1, TSC2, RPS6, MYL9, and DAPK3.

Specifications

• Accession Number: P53355
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1612
• Name: Human DAPK1 (aa 1146-1289) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D13Ucla1; DAP kinase 1; DAPK; DAPK1; DAP-Kinase; death associated protein kinase 1; death-associated protein kinase 1; DKFZp781I035; OTTHUMP00000216193
• Common Name: DAPK1
• Gene Symbol: DAPK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining