Invitrogen™ Human DAK (aa 490-570) Control Fragment Recombinant Protein

Product Code. 30198028

Brand: Invitrogen™ RP103800

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61682 (PA5-61682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been identified, but the full-length nature of only one has been determined.

Specifications

• Accession Number: Q3LXA3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26007
• Name: Human DAK (aa 490-570) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATP-dependent dihydroxyacetone kinase; BC021917; bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); Dak; DHA kinase; Dha kinase/FMN cyclase; dihydroxyacetone kinase 2 homolog; dihydroxyacetone kinase 2 homolog (S. cerevisiae); DKFZP586B1621; DKFZP586B1621 protein; FAD-AMP lyase (cyclic FMN forming); FAD-AMP lyase (cyclizing); FAD-AMP lyase cyclic FMN forming; FAD-AMP lyase cyclizing; FMN cyclase; Glycerone kinase; MGC5621; NET45; RGD1311026; testis tissue sperm-binding protein Li 84 P; TKFC; Triokinase; triokinase and FMN cyclase; triokinase, FMN cyclase; triokinase/FMN cyclase; Triose kinase; zgc:153296
• Common Name: DAK
• Gene Symbol: TKFC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining