missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198028

Invitrogen™ Human DAK (aa 490-570) Control Fragment Recombinant Protein

Product Code. 30198028
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198028

Brand: Invitrogen™ RP103800

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61682 (PA5-61682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been identified, but the full-length nature of only one has been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q3LXA3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26007
Name Human DAK (aa 490-570) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ATP-dependent dihydroxyacetone kinase; BC021917; bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); Dak; DHA kinase; Dha kinase/FMN cyclase; dihydroxyacetone kinase 2 homolog; dihydroxyacetone kinase 2 homolog (S. cerevisiae); DKFZP586B1621; DKFZP586B1621 protein; FAD-AMP lyase (cyclic FMN forming); FAD-AMP lyase (cyclizing); FAD-AMP lyase cyclic FMN forming; FAD-AMP lyase cyclizing; FMN cyclase; Glycerone kinase; MGC5621; NET45; RGD1311026; testis tissue sperm-binding protein Li 84 P; TKFC; Triokinase; triokinase and FMN cyclase; triokinase, FMN cyclase; triokinase/FMN cyclase; Triose kinase; zgc:153296
Common Name DAK
Gene Symbol TKFC
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAIL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.