Invitrogen™ Human DAGLA (aa 622-699) Control Fragment Recombinant Protein

Product Code. 30201880

Brand: Invitrogen™ RP101750

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64029 (PA5-64029. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a diacylglycerol lipase. The encoded enzyme is involved in the biosynthesis of the endocannabinoid 2-arachidonoyl-glycerol.

Specifications

• Accession Number: Q9Y4D2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 747
• Name: Human DAGLA (aa 622-699) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C11orf11; DAGL(ALPHA); DAGLA; DAGLALPHA; DGL-alpha; diacylglycerol lipase alpha; diacylglycerol lipase, alpha; KIAA0659; Neural stem cell-derived dendrite regulator; NSDDR; Sn1-specific diacylglycerol lipase alpha
• Common Name: DAGLA
• Gene Symbol: DAGLA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining