Invitrogen™ Human DACT2 (aa 505-566) Control Fragment Recombinant Protein

Product Code. 30211942

Brand: Invitrogen™ RP94930

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56414 (PA5-56414. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Wnt signaling cascade is a conserved process in multicellular animals that plays important roles during development and can contribute to cancer and other diseases. Many members of this pathway are also expressed in the postnatal tissues such as brain. One such protein is Dact2, a member of the Dact protein family that was initially identified through binding to Disheveled (Dvl), a cytoplasmic protein essential to Wnt signaling. Dact2 is most prominent during the development of the thymus kidneys, and salivary gland. Dact2 is thought to play a role distinct from that of Dact1 with Dact2 having a greater impact on a beta-catenin-independent process termed planar cell polarity/convergent-extension signaling. Furthermore, Dact2 but not Dact1 can inhibit Nodal signaling by promoting the endocytic degradation of TGF-beta receptors. At least two isoforms of Dact2 are known to exist.

Specifications

• Accession Number: Q5SW24
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 168002
• Name: Human DACT2 (aa 505-566) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900084M21Rik; A630024E20; bA503C24.7; C6orf116; Dact2; Dapper antagonist of catenin 2; dapper homolog 2; dapper homolog 2, antagonist of beta-catenin; dapper homolog 2, antagonist of beta-catenin (xenopus); dapper, antagonist of beta-catenin, homolog 2; DAPPER2; dishevelled binding antagonist of beta catenin 2; dishevelled-binding antagonist of beta-catenin 2; Dpr2; Frd2; mDpr2; PP13671; RP11-503C24.7
• Common Name: DACT2
• Gene Symbol: DACT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWPTGRGGLQRRPALAWEAPGRSCSESTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining