Invitrogen™ Human DACT1 (aa 179-270) Control Fragment Recombinant Protein

Product Code. 30213025

Brand: Invitrogen™ RP109418

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dapper homolog 1, an ortholog of Xenopus Dpr, antagonizes Wnt signaling by promoting Dvl degradation via a lysosome inhibitor-sensitive and proteasome inhibitor-insensitive mechanism. Dapper homolog 1 acts as an interacting protein for Dvl, and the interaction is formed between the DEP (Dishevelled, Egl-10, and pleckstrin) domain of Dvl and the central and C-terminal regions of Dapper homolog 1. The gene for human Dapper homolog 1 is localized on chromosomal region 14q23.1. The protein impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway. The protein is also required for normal notochord formation and is downregulated in hepatocellular carcinomas (HCC). It is expressed in human liver and various other tissues.

Specifications

• Accession Number: Q9NYF0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51339
• Name: Human DACT1 (aa 179-270) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921528D17Rik; AI115603; dact1; dact1.S; dact1-a; dact1-b; DAPPER; dapper 1; dapper 1-A; dapper antagonist of catenin 1; Dapper homolog 1; dapper homolog 1, antagonist of beta-catenin; dapper homolog 1, antagonist of beta-catenin (xenopus); dapper, antagonist of beta-catenin; dapper, antagonist of beta-catenin, homolog 1; dapper1; dapper1b; dishevelled binding antagonist of beta catenin 1; dishevelled-binding antagonist of beta-catenin 1; dishevelled-binding antagonist of beta-catenin 1 S homeolog; dishevelled-interacting protein; dpr; dpr1; frd1; FRODO; frodo 1; frodo homolog; Frodo1; functional regulator of dsh in ontogenesis; HDPR1; Hepatocellular carcinoma novel gene 3 protein; heptacellular carcinoma novel gene 3; HNG3; MDpr1; MTNG3; RGD1564008; signaling protein; thye x 3; thymus expressed gene 3; thymus-expressed novel gene 3 protein; XDpr; XDpr1b; XELAEV_18041122mg
• Common Name: DACT1
• Gene Symbol: DACT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VFSECLSSCHSSTCFCSPLEATLSLSDGCPKSADLIGLLEYKEGHCEDQASGAVCRSLSTPQFNSLDVIADVNPKYQCDLVSKNGNDVYRYP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining