missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DACT1 (aa 179-270) Control Fragment Recombinant Protein

Product Code. 30213025
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213025

Brand: Invitrogen™ RP109418

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dapper homolog 1, an ortholog of Xenopus Dpr, antagonizes Wnt signaling by promoting Dvl degradation via a lysosome inhibitor-sensitive and proteasome inhibitor-insensitive mechanism. Dapper homolog 1 acts as an interacting protein for Dvl, and the interaction is formed between the DEP (Dishevelled, Egl-10, and pleckstrin) domain of Dvl and the central and C-terminal regions of Dapper homolog 1. The gene for human Dapper homolog 1 is localized on chromosomal region 14q23.1. The protein impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway. The protein is also required for normal notochord formation and is downregulated in hepatocellular carcinomas (HCC). It is expressed in human liver and various other tissues.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NYF0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51339
Name Human DACT1 (aa 179-270) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4921528D17Rik; AI115603; dact1; dact1.S; dact1-a; dact1-b; DAPPER; dapper 1; dapper 1-A; dapper antagonist of catenin 1; Dapper homolog 1; dapper homolog 1, antagonist of beta-catenin; dapper homolog 1, antagonist of beta-catenin (xenopus); dapper, antagonist of beta-catenin; dapper, antagonist of beta-catenin, homolog 1; dapper1; dapper1b; dishevelled binding antagonist of beta catenin 1; dishevelled-binding antagonist of beta-catenin 1; dishevelled-binding antagonist of beta-catenin 1 S homeolog; dishevelled-interacting protein; dpr; dpr1; frd1; FRODO; frodo 1; frodo homolog; Frodo1; functional regulator of dsh in ontogenesis; HDPR1; Hepatocellular carcinoma novel gene 3 protein; heptacellular carcinoma novel gene 3; HNG3; MDpr1; MTNG3; RGD1564008; signaling protein; thye x 3; thymus expressed gene 3; thymus-expressed novel gene 3 protein; XDpr; XDpr1b; XELAEV_18041122mg
Common Name DACT1
Gene Symbol DACT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VFSECLSSCHSSTCFCSPLEATLSLSDGCPKSADLIGLLEYKEGHCEDQASGAVCRSLSTPQFNSLDVIADVNPKYQCDLVSKNGNDVYRYP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.