Invitrogen™ Human Cytokeratin 14 (aa 414-472) Control Fragment Recombinant Protein

Product Code. 30209062

Brand: Invitrogen™ RP93527

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110884 (PA5-110884. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytokeratins (CK) are intermediate filaments of epithelial cells, both in keratinizing tissue (ie. skin) and non-keratinizing cells (ie. mesothelial cells). At least 20 different CKs can be identified. Biochemically, most members of the CK family fall into one of two classes, type I (acidic polypeptides) and type II (basic polypeptides). Belonging to the type I subfamily of low molecular weight keratins and existing in combination with keratin 5, keratin 14 distinguishes stratified epithelial cells from simple epithelial cells and is useful in identification of squamous cell carcinomas. It is considered a prognostic marker in breast carcinomas. At least one member of the acidic family and one member of the basic family is expressed in all epithelial cells.

Specifications

• Accession Number: P02533
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3861
• Name: Human Cytokeratin 14 (aa 414-472) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI626930; CK14; CK-14; cytokeratin 14; cytokeratin-14; EBS3; EBS4; epidermolysis bullosa simplex, Dowling-Meara, Koebner; K14; Ka14; keratin 14; keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner); keratin 14, type I; keratin complex 1, acidic, gene 14; keratin, type I cytoskeletal 14; keratin, type I cytoskeletal 17; keratin-14; Koebner; Krt-1.14; Krt1-14; KRT14; LOC100737113; NFJ; Type I keratin Ka14
• Common Name: Cytokeratin 14
• Gene Symbol: KRT14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining