Invitrogen™ Human Cytokeratin 13 (aa 410-458) Control Fragment Recombinant Protein

Product Code. 30200564

Brand: Invitrogen™ RP108558

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84825 (PA5-84825. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytokeratins are a subfamily of intermediate filament proteins and are characterized by a remarkable biochemical diversity, represented in human epithelial tissues by at least 20 different polypeptides. They range in molecular weight between ∽40 kDa and ∽68 kDa and isoelectric pH between 4.9 - 7.8. The individual human cytokeratins are numbered 1 to 20. The various epithelia in the human body usually express cytokeratins which are not only characteristic of the type of epithelium, but also related to the degree of maturation or differentiation within an epithelium. Cytokeratin subtype expression patterns are used to an increasing extent in the distinction of different types of epithelial malignancies. The cytokeratin antibodies are not only of assistance in the differential diagnosis of tumors using immunohistochemistry on tissue sections, but are also a useful tool in cytopathology and flow cytometric assays.

Specifications

• Accession Number: P13646
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3860
• Name: Human Cytokeratin 13 (aa 410-458) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 47 kDa cytokeratin; CK13; CK-13; cytokeratin 13; cytokeratin-13; K13; K-13; Ka13; keratin 13; keratin 13, type I; keratin complex 1, acidic, gene 13; keratin, type I cytoskeletal 13; Keratin-13; Krt-1.13; Krt1-13; KRT13; krt13 {ECO:0000250; MGC161462; MGC3781; Type I keratin Ka13; UniProtKB:P13646}; WSN2
• Common Name: Cytokeratin 13
• Gene Symbol: KRT13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining