Invitrogen™ Human Cytohesin 4 (aa 1-36) Control Fragment Recombinant Protein

Product Code. 30206529

Brand: Invitrogen™ RP104282

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64467 (PA5-64467. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The structures of this gene and CYTH1 are very similar.

Specifications

• Accession Number: Q9UIA0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27128
• Name: Human Cytohesin 4 (aa 1-36) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CYT4; CYTH4; cytohesin 4; cytohesin-4; DJ63G5.1; PH, SEC7 and coiled-coil domain-containing protein 4; pleckstrin homology, Sec7 and coiled/coil domains 4; pleckstrin homology, Sec7 and coiled-coil domains 4; PSCD4
• Common Name: Cytohesin 4
• Gene Symbol: CYTH4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining