Invitrogen™ Human Cytochrome C1 (aa 181-322) Control Fragment Recombinant Protein

Product Code. 30181153

Brand: Invitrogen™ RP99401

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51550 (PA5-51550. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.

Specifications

• Accession Number: P08574
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1537
• Name: Human Cytochrome C1 (aa 181-322) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610002H19Rik; AA408921; Complex III subunit 4; complex III subunit IV; Cyc1; Cytochrome b-c1 complex subunit 4; cytochrome c1; cytochrome c-1; cytochrome c1, heme protein, mitochondrial; MC3DN6; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit; UQCR4
• Common Name: Cytochrome C1
• Gene Symbol: CYC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining