Invitrogen™ Human CYSLTR2 (aa 4-34) Control Fragment Recombinant Protein

Product Code. 30212151

Brand: Invitrogen™ RP89568

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Receptor for cysteinyl leukotrienes. The response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Stimulation by BAY u9773, a partial agonist, induces specific contractions of pulmonary veins and might also have an indirect role in the relaxation of the pulmonary vascular endothelium. The rank order of affinities for the leukotrienes is LTC4 = LTD4 > LTE4.

Specifications

• Accession Number: Q9NS75
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57105
• Name: Human CYSLTR2 (aa 4-34) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2300001H05Rik; Cltr2; CysLT(2); Cyslt2; CysLT-2; CYSLT2R; CYSLTR2; cysteinyl leukotriene CysLT2 receptor; cysteinyl leukotriene receptor 2; GPCR21; G-protein coupled receptor GPCR21; G-protein coupled receptor HG57; HG57; hGPCR21; HPN321; KPG_011; PSEC0146; RSBPT32
• Common Name: CYSLTR2
• Gene Symbol: CYSLTR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining