Invitrogen™ Human CYP2U1 (aa 143-225) Control Fragment Recombinant Protein

Product Code. 30207628

Brand: Invitrogen™ RP95662

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61307 (PA5-61307. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme is a hydroxylase that metabolizes arachidonic acid, docosahexaenoic acid, and other long chain fatty acids.

Specifications

• Accession Number: Q7Z449
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 113612
• Name: Human CYP2U1 (aa 143-225) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430436A10Rik; Cyp2u1; Cytochrome P450 2U1; cytochrome P450 family 2 subfamily U member 1; cytochrome P450, 2u1; cytochrome P450, family 2, subfamily U, polypeptide 1; P450TEC; spastic paraplegia 49; SPG49; SPG56
• Common Name: CYP2U1
• Gene Symbol: CYP2U1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining