Invitrogen™ Human CYP2D6 (aa 196-273) Control Fragment Recombinant Protein

Product Code. 30209109

Brand: Invitrogen™ RP100044

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83766 (PA5-83766. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytochrome p450 2D6 (CYP2D6) is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P10635
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1565
• Name: Human CYP2D6 (aa 196-273) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI303445; Cholesterol 25-hydroxylase; CPD6; CYP2D; Cyp2d10; Cyp2d-10; Cyp2d13; Cyp2d18; Cyp2d-18; Cyp2d22; Cyp2d3; Cyp2d-3; Cyp2d4; Cyp2d-4; Cyp2d4v1; Cyp2d4v2; Cyp2d6; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID10; CYPIID18; CYPIID3; CYPIID4; CYPIID6; Cytochrome P450 2D10; cytochrome P450 2d18; Cytochrome P450 2 D-29; Cytochrome P450 2D3; cytochrome P450 2 D-35; cytochrome P450 2D4; Cytochrome P450 2D6; cytochrome P450 family 2 subfamily D member 6; cytochrome P450, 2d10; cytochrome P450, family 2, subfamily d, polypeptide 10; cytochrome P450, family 2, subfamily d, polypeptide 13; cytochrome P450, family 2, subfamily d, polypeptide 22; cytochrome P450, family 2, subfamily d, polypeptide 3; cytochrome P450, family 2, subfamily d, polypeptide 4; cytochrome P450, family 2, subfamily d, polypeptide 6; cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2; cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2; cytochrome P450, subfamily 2 D, polypeptide 6; cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), polypeptide 8 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1; cytochrome P450, subfamily IID, polypeptide 6; Cytochrome P450, subfamily IID3; Cytochrome P450, subfamily IID4; cytochrome P450-16-alpha; Cytochrome P450CB; Cytochrome P450-CMF3; cytochrome P450-DB1; Cytochrome P450-DB3; cytochrome P450-DB4; debrisoquine 4-hydroxylase; flavoprotein-linked monooxygenase; microsomal monooxygenase; nonfunctional cytochrome P450 2D6; P450 2 D-29/2 D-35; P450-2 D; P450C2D; P450-CMF3; P450DB1; P450-DB1; P450-DB3; P450-DB4; testosterone 16-alpha hydroxylase; xenobiotic monooxygenase
• Common Name: CYP2D6
• Gene Symbol: CYP2D6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining