missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CYP2B6 Control Fragment Recombinant Protein

Product Code. 30207135
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207135

Brand: Invitrogen™ RP107210

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66547 (PA5-66547. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P20813
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1555
Name Human CYP2B6 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1,4-cineole 2-exo-monooxygenase; CPB6; CYP2B; CYP2B11; Cyp2b3; Cyp2b-3; CYP2B30; CYP2B6; CYP2B7; CYP2B7P; CYPIIB11; CYPIIB3; CYPIIB6; cytochrome P450 2B11; Cytochrome P450 2B3; cytochrome P450 2B6; cytochrome P450 CYP2B30; cytochrome P450 family 2 subfamily B member 6; cytochrome P-450 IIB; cytochrome P450 IIB1; Cytochrome P450 PBD-2; cytochrome P450, family 2, subfamily B, polypeptide 11; cytochrome P450, family 2, subfamily b, polypeptide 3; cytochrome P450, family 2, subfamily B, polypeptide 6; cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6; cytochrome P450IIB3; Cytochrome-P450-2B11; EFVM; IIB1; P450
Common Name CYP2B6
Gene Symbol CYP2B6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EAQCLIEELRKSKGALVDPTFLFHSITANIICSI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.