Invitrogen™ Human CYP2B6 Control Fragment Recombinant Protein

Product Code. 30207135

Brand: Invitrogen™ RP107210

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66547 (PA5-66547. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.

Specifications

• Accession Number: P20813
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1555
• Name: Human CYP2B6 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1,4-cineole 2-exo-monooxygenase; CPB6; CYP2B; CYP2B11; Cyp2b3; Cyp2b-3; CYP2B30; CYP2B6; CYP2B7; CYP2B7P; CYPIIB11; CYPIIB3; CYPIIB6; cytochrome P450 2B11; Cytochrome P450 2B3; cytochrome P450 2B6; cytochrome P450 CYP2B30; cytochrome P450 family 2 subfamily B member 6; cytochrome P-450 IIB; cytochrome P450 IIB1; Cytochrome P450 PBD-2; cytochrome P450, family 2, subfamily B, polypeptide 11; cytochrome P450, family 2, subfamily b, polypeptide 3; cytochrome P450, family 2, subfamily B, polypeptide 6; cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6; cytochrome P450IIB3; Cytochrome-P450-2B11; EFVM; IIB1; P450
• Common Name: CYP2B6
• Gene Symbol: CYP2B6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EAQCLIEELRKSKGALVDPTFLFHSITANIICSI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining