Invitrogen™ Human CYP27C1 (aa 412-487) Control Fragment Recombinant Protein

Product Code. 30204817

Brand: Invitrogen™ RP107648

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67008 (PA5-67008. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Specifications

• Accession Number: Q4G0S4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 339761
• Name: Human CYP27C1 (aa 412-487) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: All-trans retinol 3,4-desaturase; CYP27C1; Cytochrome P450 27C1; cytochrome P450 family 27 subfamily C member 1; cytochrome P450, family 27, subfamily C, polypeptide 1; cytochrome P450, family 27, subfamily C, polypeptide 13
• Common Name: CYP27C1
• Gene Symbol: CYP27C1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining