Invitrogen™ Human CYP27A1 (aa 53-190) Control Fragment Recombinant Protein

Product Code. 30194662

Brand: Invitrogen™ RP90768

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63674 (PA5-63674. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CYP27A1 participates in the degradation of cholesterol to bile acids in both the classic and acidic pathways. [1] It is the initiating enzyme in the acidic pathway to bile acids, yielding oxysterols by introducing a hydroxyl group to the carbon at the 27 position in cholesterol. In the acidic pathway, it produces 27-hydroxycholesterol from cholesterol whereas in the classic or neutral pathway, it produces 3beta-hydroxy-5-cholestenoic acid. It is also involved in the metabolism of vitamin D3. While CYP27A1 is present in many different tissues, its function in these tissues is largely uncharacterized. In macrophages, 27-hydroxycholesterol generated by this enzyme may be helpful against the production of inflammatory factors associated with cardiovascular disease.

Specifications

• Accession Number: Q02318
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1593
• Name: Human CYP27A1 (aa 53-190) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300013A03Rik; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase; 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 26-hydroxylase; 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase; cholestanetriol 26-monooxygenase; cholesterol 27 hydroxylase; CP27; CTX; CYP27; CYP27A1; cyt; cytochrome P450 27; cytochrome P450 family 27 subfamily A member 1; cytochrome P450, 27; cytochrome P450, 27a1; cytochrome P450, family 27, subfamily a, polypeptide 1; cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinous xanthomatosis), polypeptide 1; Cytochrome P-450C27/25; P450C27; Sterol 26-hydroxylase, mitochondrial; sterol 27-hydroxylase; Vitamin D(3) 25-hydroxylase
• Common Name: CYP27A1
• Gene Symbol: CYP27A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining