missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198694

Invitrogen™ Human CYP26B1 (aa 201-310) Control Fragment Recombinant Protein

Product Code. 30198694
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198694

Brand: Invitrogen™ RP89825

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52948 (PA5-52948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NR63
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56603
Name Human CYP26B1 (aa 201-310) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CP26; CYP26A2; CYP26B1; Cytochrome P450 26A2; Cytochrome P450 26B1; cytochrome P450 family 26 subfamily A member 1; cytochrome P450 family 26 subfamily B member 1; cytochrome P450 retinoic acid-inactivating 2; cytochrome P450 retinoid metabolizing protein; cytochrome P450, 26, retinoic acid B1; cytochrome P450, family 26, subfamily b, polypeptide 1; cytochrome P450, subfamily XXVIB, polypeptide 1; cytochrome P450RAI-2; dol; fc21d03; P450 26A2; P450 enzyme to degrade retinoic acid; P450RAI2; P450RAI-2; retinoic acid B1; retinoic acid hydroxylase; retinoic acid-metabolizing cytochrome; RHFCA; stocksteif; wu:fc21d03; wu:fc26h10; zgc:76999
Common Name CYP26B1
Gene Symbol CYP26B1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRRGIQARQILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELIFAAYATTASASTSLIM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.