Invitrogen™ Human CYP17A1 (aa 41-181) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30209826	100 μL	100µL

Product Code. 30209826 Supplier Invitrogen™ Supplier No. RP102429

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111277 (PA5-111277. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.

Specifications

• Accession Number: P05093
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1586
• Name: Human CYP17A1 (aa 41-181) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 17 A-hydroxylase; 17-alpha-hydroxyprogesterone aldolase; CPT7; Cyp17; Cyp17a1; CYPXVII; cytochrome P450 17A1; cytochrome P450 family 17 subfamily A member 1; cytochrome p450 XVIIA1; cytochrome P450, 17; cytochrome P450, 17a1; cytochrome P450, family 17, subfamily A, polypeptide 1; cytochrome P450, subfamily 17; Cytochrome P450, subfamily XVII; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; Cytochrome P450c17; cytochrome P450-C17; HGNC:2593; P45017alpha; p450c17; P450-C17; S17AH; steroid 17-alpha hydroxylase; steroid 17-alpha-hydroxylase/17,20 lyase; Steroid 17-alpha-monooxygenase
• Common Name: CYP17A1
• Gene Symbol: CYP17A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining