Invitrogen™ Human CYP11B2 (aa 116-150) Control Fragment Recombinant Protein

Product Code. 30210967

Brand: Invitrogen™ RP110197

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144829 (PA5-144829. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene.

Specifications

• Accession Number: P19099
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1585
• Name: Human CYP11B2 (aa 116-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALDOS; Aldosterone synthase; aldosterone-synthesizing enzyme; Corticosterone 18-monooxygenase, CYP11B2; Cp45as; Cpn2; Cyp11b; CYP11B2; Cyp11b-2; Cyp11b3; CYP11BL; CYPXIB2; CYPXIB3; cytochrome P450 11B2, mitochondrial; cytochrome P450 11B3, mitochondrial; cytochrome P450 family 11 subfamily B member 2; Cytochrome P450 subfamily XIB polypeptide 2 (aldosterone synthase); cytochrome P450, family 11, subfamily b, polypeptide 2; cytochrome P450, subfamily 11 B, polypeptide 2; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2; Cytochrome P450, subfamily XIB, polypeptide 2 (aldosterone synthase); cytochrome P-450 Aldo; cytochrome P450-Aldo-1; cytochrome P450-Aldo-2; cytochrome P450C11; Cytochrome P-450C18; mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2; P450aldo; P450-Aldo-1; P450-Aldo-2; P450C 18; P-450 C 18; P450C18; P-450C18; RNCP45AS; steroid 11-beta/18-hydroxylase; steroid 11-beta-hydroxylase; Steroid 11-beta-hydroxylase, CYP11B2; steroid 11-beta-monooxygenase; Steroid 18-hydroxylase; steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo; steroid-11-beta-hydroxylase
• Common Name: CYP11B2
• Gene Symbol: CYP11B2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining