Invitrogen™ Human CYLD (aa 83-174) Control Fragment Recombinant Protein

Product Code. 30196640

Brand: Invitrogen™ RP110206

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CYLD is a 956 aa, cytoplasmic, deubiquitinating enzyme belonging to the ubiquitin carboxy-terminal hydrolases (UCH) family of proteins with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains, a proline rich region, a SH3 binding domain and a sequence homology to catalytic domain of UCH. CYLD is identified as a tumor suppressor protein affecting the JNK signaling pathway. CYLD is a negative regulator of TRAF2 and NF-kappa-B signaling pathway and is also known to have receptor-dependent role in regulating the I-kappa-B kinase pathway. It also has a deubiquitinating activity that is directed towards non-Lys-48-linked polyubiquitin chains and TRAP1 is a novel substrate for deubiquitination. Mutated CYLD is known to be associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome.

Specifications

• Accession Number: Q9NQC7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1540
• Name: Human CYLD (aa 83-174) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010013M14Rik; 2900009M21Rik; BRSS; C130039D01Rik; CDMT; Cyld; CYLD lysine 63 deubiquitinase; CYLD1; CYLDI; cylindromatosis (turban tumor syndrome); deubiquitinating enzyme CYLD; EAC; FLJ20180; FLJ31664; FLJ78684; HSPC057; KIAA0849; LRRGT00003; MFT; MFT1; mKIAA0849; probable ubiquitin carboxyl-terminal hydrolase CYLD; retinitis pigmentosa 1 homolog; Rp1; Rp1h; SBS; TEM; ubiquitin carboxyl-terminal hydrolase CYLD; ubiquitin specific peptidase like 2; ubiquitin thioesterase CYLD; ubiquitin thiolesterase CYLD; ubiquitin-specific-processing protease CYLD; Unknown (protein for MGC:137952); USPL2
• Common Name: CYLD
• Gene Symbol: CYLD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining