Invitrogen™ Human Cyclin T1 (aa 410-496) Control Fragment Recombinant Protein

Product Code. 30210119

Brand: Invitrogen™ RP109275

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: O60563
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 904
• Name: Human Cyclin T1 (aa 410-496) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810478G24Rik; AI115585; CCNT; CCNT1; CDK9-associated C-type protein; cyclin C-related protein; cyclin T1; cyclin T1b; cyclin-T; cyclin-T1; CycT1; HIVE1; human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1
• Common Name: Cyclin T1
• Gene Symbol: Ccnt1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining