Invitrogen™ Human Cyclin L2 (aa 39-84) Control Fragment Recombinant Protein

Product Code. 30211995

Brand: Invitrogen™ RP100477

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62738 (PA5-62738. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCNL2 belongs to the cyclin family, Cyclin L subfamily. CCNL2 is a transcriptional regulator which participates in regulating the pre-mRNA splicing process. CCNL2 also modulates the expression of critical apoptotic factor, leading to cell apoptosis.

Specifications

• Accession Number: Q96S94
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 81669
• Name: Human Cyclin L2 (aa 39-84) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700010A01Rik; 1810019L15Rik; 2010319M22Rik; AA409936; Ania6b; ANIA-6 B; AW261738; Ccnl2; CCNM; CCNS; Cyclin Ania-6 b; cyclin L2; cyclin M; cyclin S; cyclin-L2; HCLA-150; HCLA-ISO; HLA-ISO; hypothetical protein LOC538796; MNCb-5160; paneth cell enhanced expression; paneth cell-enhanced expression protein; PCEE; SB138
• Common Name: Cyclin L2
• Gene Symbol: CCNL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining