Invitrogen™ Human Cyclin A1 (aa 17-124) Control Fragment Recombinant Protein

Product Code. 30194884

Brand: Invitrogen™ RP107025

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111508 (PA5-111508. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclins are regulatory subunits of the cyclin-dependent kinases (cdk's). They are expressed temporally to control transition at different specific phases of the cell cycle. In mammalian somatic cells, cyclin A is required for S-phase and passage through G2-phase.

Specifications

• Accession Number: P78396
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8900
• Name: Human Cyclin A1 (aa 17-124) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CCNA1; CT146; cyclin A1; cyclin-A1; testicular tissue protein Li 34
• Common Name: Cyclin A1
• Gene Symbol: CCNA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining