Invitrogen™ Human CYB5R2 (aa 102-153) Control Fragment Recombinant Protein

Product Code. 30199132

Brand: Invitrogen™ RP97438

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58611 (PA5-58611. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CYB5R2 is an NADH-cytochrome b5 reductase which are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1).

Specifications

• Accession Number: Q6BCY4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51700
• Name: Human CYB5R2 (aa 102-153) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: b5R0.2; b5R2; CYB5R2; cytochrome b5 reductase 2; cytochrome b5 reductase b5R0.2; D630003K02Rik; NADH-cytochrome b5 reductase 2; RGD1308421
• Common Name: CYB5R2
• Gene Symbol: CYB5R2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining