Invitrogen™ Human CWC15 (aa 13-90) Control Fragment Recombinant Protein

Product Code. 30207016

Brand: Invitrogen™ RP97379

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58962 (PA5-58962. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cwc15 gene ontology annotations related to this gene include mRNA splicing, via spliceosome.

Specifications

• Accession Number: Q9P013
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51503
• Name: Human CWC15 (aa 13-90) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610040D20Rik; 2900052N06Rik; AD002; AD-002; C11orf5; CWC15; CWC15 homolog (S. cerevisiae); CWC15 spliceosome-associated protein; CWC15 spliceosome-associated protein homolog; CWC15 spliceosome-associated protein homolog (S. cerevisiae); Cwf15; Ed1; Embryonic development factor 1; HSPC148; mED1; nucleoporin; ORF5; protein CWC15 homolog; putative protein CWC15 like protein; spliceosome-associated protein CWC15 homolog
• Common Name: CWC15
• Gene Symbol: Cwc15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining