Invitrogen™ Human CUTC (aa 104-175) Control Fragment Recombinant Protein

Product Code. 30212809

Brand: Invitrogen™ RP108956

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140092 (PA5-140092. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 ; Li et al., 2005 ).

Specifications

• Accession Number: Q9NTM9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51076
• Name: Human CUTC (aa 104-175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310039I18Rik; AI326282; CGI-32; Copper homeostasis protein cutC homolog; Cutc; cutC copper transporter; cutC copper transporter homolog; cutC copper transporter homolog (E.coli); RP11-483F11.3
• Common Name: CUTC
• Gene Symbol: CUTC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining