Invitrogen™ Human CUGBP1 (aa 195-266) Control Fragment Recombinant Protein

Product Code. 30212550

Brand: Invitrogen™ RP104793

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83728 (PA5-83728. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Myotonic dystrophy (MD) is an autosomal dominant neuromuscular disease that is associated with a (CTG)n repeat expansion in the 3'-untranslated region of the myotonin protein kinase (Mt-PK) gene. A (CUG) n oligonucleotides triplet repeat pre-mRNA/mRNA binding protein may play an important role in DM pathogenesis. HeLa cell protein, CUG-BP1, has been purified based upon its ability to bind specifically to (CUG) 8 oligonucleotides in vitro. CUG-BP1 is the major (CUG) 8 binding activity in normal cells. CUG-BP1 has been identified as isoforms of a novel heterogeneous nuclear ribonucleoprotein (hnRNP), hNab50. The CUG-BP/hNab50 protein is localized predominantly in the nucleus and is associated with polyadenylated RNAs in vivo. In vitro RNA-binding/photocrosslinking studies demonstrate that CUG-BP/hNab50 binds to RNAs containing the Mt-PK 3-UTR. The (CUG) n repeat region in Mt-PK mRNA is a binding site for CUG-BP/hNab50 in vivo, and triplet repeat expansion leads to sequestration of this hnRNP on mutant Mt-PK transcripts.

Specifications

• Accession Number: Q92879
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10658
• Name: Human CUGBP1 (aa 195-266) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1600010O03Rik; 50 kDa nuclear polyadenylated RNA-binding protein; AA407467; Brain protein F41; Brunol2; bruno-like 2; bruno-like protein 2; Celf1; CELF-1; CUG RNA-binding protein; CUG triplet repeat RNA-binding protein 1; CUG triplet repeat, RNA binding protein 1; CUG triplet repeat, RNA-binding protein 1; Cugbp; CUG-BP; CUG-BP- and ETR-3-like factor 1; CUGBP Ela; CUGBP Elav-like family member 1; CUGBP, Elav-like family member 1; CUGBP, Elav-like family member 1-like; CUGBP1; CUG-BP1; D2Wsu101e; Deadenylation factor CUG-BP; deadenylation factor EDEN-BP; EDEN-BP; EDEN-BP homolog; embryo deadenylation element binding protein; embryo deadenylation element-binding protein homolog; HNAB50; NAB50; NAPOR; nuclear polyadenylated RNA-binding protein, 50-kD; RNA-binding protein BRUNOL-2; RP23-147D3.7
• Common Name: CUGBP1
• Gene Symbol: CELF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining