missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CUEDC2 (aa 23-109) Control Fragment Recombinant Protein

Product Code. 30193620
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193620

Brand: Invitrogen™ RP97041

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83341 (PA5-83341. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CUE (coupling of ubiquitin conjugation to endoplasmic reticulum degradation) domain is an evolutionarily conserved, approximately 40 amino acid monoubiquitin-binding domain that mediates intramolecular monoubiquitylation. CUE domains are present in eukaryotic proteins that are involved in ubiquitination and protein trafficking pathways and may be required for ubiquitination of the proteins in which they are found. CUEDC2 (CUE domain-containing protein 2) was found through a yeast two-hybrid screening as a protein that interacts with the progesterone receptor (PR) and promotes progesterone-induced PR degradation by the ubiquitin-proteasome pathway. CUEDC2 also decreases the sumoylation of PR. CUEDC2 has also been found to interact with IKK-alpha and IKK-beta and decrease the activation of NF-kappa-B by decreasing the activation of IKK.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H467
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79004
Name Human CUEDC2 (aa 23-109) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3010002G01Rik; bA18I14.5; C10orf66; CUE domain containing 2; CUE domain-containing protein 2; CUEDC2; HOYS6; Unknown (protein for MGC:128745)
Common Name CUEDC2
Gene Symbol CUEDC2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.