missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182318

Invitrogen™ Human CTU2 Control Fragment Recombinant Protein

Product Code. 30182318
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182318

Brand: Invitrogen™ RP98583

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59441 (PA5-59441. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytoplasmic tRNA 2-thiolation protein 2 (CUT2), also named as C16orf84 or NCS2, is a 515 amino acid protein, which belongs to the CUT2 family. C16orf84 localizes in the cytoplasm and Plays a central role in 2-thiolation of mcm5S2U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). C16orf84 may act by forming a heterodimer with CTU1/ATPBD3 that ligates sulfur from thio-carboxylated URM1 onto the uridine of tRNAs at wobble position.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q2VPK5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 348180
Name Human CTU2 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310061F22Rik; C16orf84; Ctu2; Cytoplasmic tRNA 2-thiolation protein 2; cytoplasmic tRNA 2-thiolation protein 2 {ECO:0000255; cytosolic thiouridylase subunit 2; cytosolic thiouridylase subunit 2 homolog; cytosolic thiouridylase subunit 2 homolog (S. pombe); HAMAP-Rule:MF_03054}; Ncs2; UPF0432
Common Name CTU2
Gene Symbol CTU2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSPDSFCLGFSEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.