missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199662

Invitrogen™ Human CTR2 (aa 40-92) Control Fragment Recombinant Protein

Product Code. 30199662
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199662

Brand: Invitrogen™ RP91104

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53246 (PA5-53246. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Copper is a trace element that plays an essential role for organisms that utilize oxygen during respiration. CTR2 is a membrane protein that is a member of the SLC31A transporter family. Although the function of CTR2 is still poorly understood in mammalian cells, it is expected to be involved in low-affinity copper uptake. It is believed to be confined to lysosomes which stimulate copper delivery to the the cytosol of human cells at high concentrations.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15432
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1318
Name Human CTR2 (aa 40-92) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI604396; Copper transporter 2; COPT2; CTR2; hCTR2; probable low affinity copper uptake protein 2; RP11-9H12.2; SLC31A2; solute carrier family 31 (copper transporter), member 2; solute carrier family 31 (copper transporters), member 2; solute carrier family 31 member 2; solute carrier family 31, member 2
Common Name CTR2
Gene Symbol SLC31A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.