missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CtIP (aa 497-597) Control Fragment Recombinant Protein

Product Code. 30204991
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204991

Brand: Invitrogen™ RP106429

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84133 (PA5-84133. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CtIP, a 125 kD protein, was originally found interacting with a transcription repressor, CtBP, through the PLDLS motif (CtBP-Interacting Protein) thus suggested a role in transcription. Studies have shown that CtIP also interacts with BRCA1 protein through the c-terminus BRCT domains also suggested that CtIP is a potential tumor suppressor. This CtIP-BRCA1 interaction can be disrupted by DNA damaging agents including UV or gamma-irradiation. Li et al (Nature 406, 210 - 215 (2000)) have shown that ATM phosphorylates CtIP at serine residues 664 and 745, and mutation of these sites abrogates the dissociation of BRCA1 from CtIP, resulting in persistent repression of BRCA1-dependent induction of GADD45 upon ionizing radiation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99708
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5932
Name Human CtIP (aa 497-597) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9930104E21Rik; COM1; CtBP-interacting protein; CtIP; DNA endonuclease RBBP8; JWDS; RB binding protein 8, endonuclease; RBBP8; RBBP-8; retinoblastoma binding protein 8; retinoblastoma-binding protein 8; Retinoblastoma-interacting protein and myosin-like; RGD1308872; RIM; SAE2; SCKL2; Sporulation in the absence of SPO11 protein 2 homolog
Common Name CtIP
Gene Symbol Rbbp8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.