Invitrogen™ Human CtIP (aa 497-597) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30204991	100 μL	100µL

Product Code. 30204991 Supplier Invitrogen™ Supplier No. RP106429

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84133 (PA5-84133. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CtIP, a 125 kD protein, was originally found interacting with a transcription repressor, CtBP, through the PLDLS motif (CtBP-Interacting Protein) thus suggested a role in transcription. Studies have shown that CtIP also interacts with BRCA1 protein through the c-terminus BRCT domains also suggested that CtIP is a potential tumor suppressor. This CtIP-BRCA1 interaction can be disrupted by DNA damaging agents including UV or gamma-irradiation. Li et al (Nature 406, 210 - 215 (2000)) have shown that ATM phosphorylates CtIP at serine residues 664 and 745, and mutation of these sites abrogates the dissociation of BRCA1 from CtIP, resulting in persistent repression of BRCA1-dependent induction of GADD45 upon ionizing radiation.

Specifications

• Accession Number: Q99708
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5932
• Name: Human CtIP (aa 497-597) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9930104E21Rik; COM1; CtBP-interacting protein; CtIP; DNA endonuclease RBBP8; JWDS; RB binding protein 8, endonuclease; RBBP8; RBBP-8; retinoblastoma binding protein 8; retinoblastoma-binding protein 8; Retinoblastoma-interacting protein and myosin-like; RGD1308872; RIM; SAE2; SCKL2; Sporulation in the absence of SPO11 protein 2 homolog
• Common Name: CtIP
• Gene Symbol: Rbbp8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining