missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CT45A (aa 5-54) Control Fragment Recombinant Protein

Product Code. 30211910
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211910

Brand: Invitrogen™ RP104370

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60807 (PA5-60807. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CT45A3 (Cancer/Testis Antigen Family 45 Member A3) is a Protein Coding gene. An important paralog of this gene is CT45A1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P0DMU7, P0DMU8, P0DMU9, Q5HYN5, Q8NHU0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 102723631, 441519, 441521, 541465, 541466
Name Human CT45A (aa 5-54) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cancer/testis antigen 45-1; Cancer/testis antigen 45-3; cancer/testis antigen 45-4; cancer/testis antigen 45-4/6; cancer/testis antigen 45-5; Cancer/testis antigen 45-6; cancer/testis antigen 45A1; Cancer/testis antigen 45A10; cancer/testis antigen 45A3; Cancer/testis antigen 45A4; cancer/testis antigen 45A4/45A6; cancer/testis antigen 45A5; Cancer/testis antigen 45A6; Cancer/testis antigen 45A7; cancer/testis antigen CT45-1; cancer/testis antigen CT45-3; cancer/testis antigen CT45-5; cancer/testis antigen CT45-6; cancer/testis antigen family 45 member A1; Cancer/testis antigen family 45 member A10; cancer/testis antigen family 45 member A3; Cancer/testis antigen family 45 member A4; cancer/testis antigen family 45 member A4/A6; cancer/testis antigen family 45 member A5; Cancer/testis antigen family 45 member A6; Cancer/testis antigen family 45 member A7; cancer/testis antigen family 45 member A-like; cancer/testis antigen family 45, member A1; cancer/testis antigen family 45, member A10; cancer/testis antigen family 45, member A3; cancer/testis antigen family 45, member A4; cancer/testis antigen family 45, member A5; cancer/testis antigen family 45, member A6; CT45; CT45.1; CT45.3; CT45.4; CT45.5; CT45.6; CT45-1; CT45-3; CT45-4; CT455; CT45-5; CT45-6; CT45A1; CT45A10; CT45A3; CT45A4; CT45A5; CT45A6; CT45A7
Common Name CT45A
Gene Symbol CT45A1, CT45A10, CT45A3, CT45A5, CT45A6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.