Invitrogen™ Human CSRP2BP (aa 525-624) Control Fragment Recombinant Protein

Product Code. 30209187

Brand: Invitrogen™ RP105448

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111634 (PA5-111634. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CSRP2 is a protein containing two LIM domains, which are double zinc finger motifs found in proteins of diverse function. CSRP2 and some related proteins are thought to act as protein adapters, bridging two or more proteins to form a larger protein complex. The protein encoded by this gene binds to one of the LIM domains of CSRP2 and contains an acetyltransferase domain. Although the encoded protein has been detected in the cytoplasm, it is predominantly a nuclear protein. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9H8E8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57325
• Name: Human CSRP2BP (aa 525-624) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2510008M08Rik; ADA2A-containing complex subunit 2; ATAC component 2 homolog; ATAC2; AU023459; CRP2 binding partner; CRP2 binding protein; CRP2-binding partner; CRP2BP; CSRP2 binding protein; CSRP2-binding protein; Csrp2bp; cysteine and glycine-rich protein 2 binding protein; cysteine-rich protein 2 binding protein; cysteine-rich protein 2-binding protein; D2Ertd473e; D2Wsu131e; dJ717M23.1; E430020F17; Kat14; Lysine acetyltransferase 14; PRO1194
• Common Name: CSRP2BP
• Gene Symbol: KAT14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining