Invitrogen™ Human CSPG5 Control Fragment Recombinant Protein

Product Code. 30210152

Brand: Invitrogen™ RP107601

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66956 (PA5-66956. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Neuroglycan C is a transmembrane chondroitin sulfate proteoglycan that is exclusively expressed in the central nervous system. NGC gene expression is developmentally regulated being altered by addiction to psychostimulants and by nerve lesion. Its core protein has a particular multidomain structure differing from those of other known proteoglycans, and this protein is modified post-translationally in various ways such as phosphorylation and glycosylation. Neuroglycan C is a novel part-time proteoglycan that changes its structure from a proteoglycan form to a non-proteoglycan form without chondroitin sulfate chains during the development of the cerebellum and retina. Evidence suggests that Neuroglycan C is involved in neuronal circuit formation in the central nervous system.

Specifications

• Accession Number: O95196
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10675
• Name: Human CSPG5 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: acidic leucine-rich EGF-like domain-containing brain protein; Caleb; chondroitin sulfate proteoglycan 5; chondroitin sulfate proteoglycan 5 (neuroglycan C); Cspg5; MGC44034; Neuroglycan C; Ngc
• Common Name: CSPG5
• Gene Symbol: CSPG5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GGVTAKAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining