Invitrogen™ Human CSN1S1 (aa 110-166) Control Fragment Recombinant Protein

Product Code. 30212502

Brand: Invitrogen™ RP106746

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84325 (PA5-84325. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CASA play an important role in the capacity of milk to transport calcium phosphate. Casoxin D acts as opioid antagonist and has vasorelaxing activity mediated by bradykinin B1 receptors.

Specifications

• Accession Number: P47710
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1446
• Name: Human CSN1S1 (aa 110-166) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA959832; alpha S1-casein B; alpha-casein; Alpha-S1-casein; alpha-s1-casein precursor; Antioxidant peptide; AW212882; Bos d 8; CASA; casein alpha s1; casein alpha-S1; casein, alpha; Casoxin-D; Csn1; CSN1S1; Csna
• Common Name: CSN1S1
• Gene Symbol: CSN1S1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining