Invitrogen™ Human CSK (aa 370-449) Control Fragment Recombinant Protein

Product Code. 30197732

Brand: Invitrogen™ RP95238

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83012 (PA5-83012. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CSK is a tyrosine kinase that has been shown to downregulate the activity of SRC oncoprotein through phosphorylation of its carboxy terminus. Since cell transformation by SRC is caused by various mechanisms that interfere with this phosphorylation, the CSK gene might function as an antioncogene. CSK plays an important role in the regulation of cell growth, differentiation, migration, and immune responses. CSK phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases including LCK, SRC, HCK, FYN, LYN, CSK, and YES1. CSK is expressed ubiquitously as a protein of approximately 50 KDa in cytosol, but a fraction distributes to lipid rafts due to interaction with the lipid raft-associated protein PAG (Csk-binding protein).

Specifications

• Accession Number: P41240
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1445
• Name: Human CSK (aa 370-449) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW212630; CSK; CSK, non-receptor tyrosine kinase; C-SRC kinase; c-src tyrosine kinase; C-terminal Src kinase; MGC117393; p50CSK; protein-tyrosine kinase (CSK); protein-tyrosine kinase CYL; Protein-tyrosine kinase MPK-2; Tyrosine-protein kinase CSK
• Common Name: CSK
• Gene Symbol: CSK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining